Scaffold FS9038012H_103097

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FS9038012H_103097

Scaffold FS9038012H_103097

Overview

Basic Information
Taxon OID	3300002594 Open in IMG/M
Scaffold ID	FS9038012H_103097 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_80_12H
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	621
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location Name	Marker 113, Axial Seamount, Northeast Pacific Ocean
Coordinates	Lat. (^o)	45.922741	Long. (^o)	-129.988104	Alt. (m)		Depth (m)	1522
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058997	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
FS9038012H_1030973	F058997	GGA	MIIYKGREMTVREACALMGIDCDDFMAWCKKFALQNYSYALNYYKRTLKFKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.