NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002594

3300002594: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_80_12H



Overview

Basic Information
IMG/M Taxon OID3300002594 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0093366 | Ga0041819
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_80_12H
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3566780
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → Xanthobacter autotrophicus1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. AAUFL_F1_KS471

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 113, Axial Seamount, Northeast Pacific Ocean
CoordinatesLat. (o)45.922741Long. (o)-129.988104Alt. (m)N/ADepth (m)1522
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042865Metagenome / Metatranscriptome157N
F051069Metagenome / Metatranscriptome144N
F058934Metagenome / Metatranscriptome134N
F058997Metagenome / Metatranscriptome134N
F074867Metagenome / Metatranscriptome119N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
FS9038012H_100091Not Available513Open in IMG/M
FS9038012H_101130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → Xanthobacter autotrophicus781Open in IMG/M
FS9038012H_102242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae506Open in IMG/M
FS9038012H_102416All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. AAUFL_F1_KS47617Open in IMG/M
FS9038012H_103097Not Available621Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
FS9038012H_100091FS9038012H_1000912F042865MALRVPDYETFLAADDFNKRIWWSFMQSVVNDLPLNGNVAPENIVRANKSCLYIQSTGGTAVLWFNPNGNGSATGWIVK*
FS9038012H_101130FS9038012H_1011301F051069MAYRVSISSTELVTRAEVVAYAKIENTDENTIIDALITSSREELENLLKIPLITQVWAQTYDSFIEPVYAPFIPLTSAALEIADSDGNFSANTYISVKKDTGRIAPTDVFSPSLQFDGFKITFTYTVSAIDAALKTAIMELTSYRFYNRGNLEAAKIPASVLSMVGHLRVFSV*
FS9038012H_102242FS9038012H_1022421F074867MSSRGITDIILNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKTGDVVSIIQVCAVPANGRKFHNWWNRDGVGESVIGAGLVDITTSVTHFLAKALTAGTETDIKTVGSESDEKK*
FS9038012H_102416FS9038012H_1024161F058934GQTIPTANPVIADADGFLASFYWTGTVDVVLTDENNNLIDSANGIQDLVSTINAIVVAGNITLPFGYASGDGDTITTILPIASDFSDGGVFVVRANTANSGASNTPNLQVNSYASRRIKKIGGVALIASDIVSGMNMILVYNKAQNCYYLINHEATFLKRDGTAKMLGAIDMDSHKITNLTAGTDNGDAVNYLQLGGDSSREFLA
FS9038012H_103097FS9038012H_1030973F058997MIIYKGREMTVREACALMGIDCDDFMAWCKKFALQNYSYALNYYKRTLKFKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.