NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FS9038012H_102416

Scaffold FS9038012H_102416


Overview

Basic Information
Taxon OID3300002594 Open in IMG/M
Scaffold IDFS9038012H_102416 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_80_12H
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)617
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. AAUFL_F1_KS47(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameMarker 113, Axial Seamount, Northeast Pacific Ocean
CoordinatesLat. (o)45.922741Long. (o)-129.988104Alt. (m)Depth (m)1522
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058934Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
FS9038012H_1024161F058934N/AGQTIPTANPVIADADGFLASFYWTGTVDVVLTDENNNLIDSANGIQDLVSTINAIVVAGNITLPFGYASGDGDTITTILPIASDFSDGGVFVVRANTANSGASNTPNLQVNSYASRRIKKIGGVALIASDIVSGMNMILVYNKAQNCYYLINHEATFLKRDGTAKMLGAIDMDSHKITNLTAGTDNGDAVNYLQLGGDSSREFLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.