Scaffold FS9035512H_10695

Overview

Basic Information

• Taxon OID: 3300002592
• Scaffold ID: FS9035512H_10695
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_55_12H
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Marker 113, Axial Seamount, Northeast Pacific Ocean
• Coordinates
  • Lat. (^o): 45.922741
  • Long. (^o): -129.988104
  • Depth (m): 1522

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043390	Metagenome / Metatranscriptome	156	N

Sequences

Protein ID	Family	RBS	Sequence
FS9035512H_106952	F043390	GGAG	MMSYQVKTEDLTKVISLTLTAEQLETIAGALEMYCIGLAEHNDPHLKYAAAAQEAIINVLESNFSVEV*