3300002592: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_55_12H

Overview

Basic Information

• IMG/M Taxon OID: 3300002592
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111355 | Gp0093362 | Ga0041815
• Sample Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_55_12H
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1766482
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Marker 113, Axial Seamount, Northeast Pacific Ocean
• Coordinates
  • Lat. (^o): 45.922741
  • Long. (^o): -129.988104
  • Alt. (m): N/A
  • Depth (m): 1522

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043390	Metagenome / Metatranscriptome	156	N
F091607	Metagenome / Metatranscriptome	107	N

Associated Scaffolds

Scaffold	Taxonomy	Length
FS9035512H_10195	Not Available	596
FS9035512H_10695	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	510

Sequences

Scaffold ID	Protein ID	Family	Sequence
FS9035512H_10195	FS9035512H_101951	F091607	MSLELQISELNATIKTLNENILLLLGSKDQHSKVECSLVEPVNLGQTEQQTFLPEVAKSDEYTREQLQSLCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCYSMIAQATKDD
FS9035512H_10695	FS9035512H_106952	F043390	MMSYQVKTEDLTKVISLTLTAEQLETIAGALEMYCIGLAEHNDPHLKYAAAAQEAIINVLESNFSVEV*