Scaffold JGI25319J35699_1000761

Overview

Basic Information

• Taxon OID: 3300002544
• Scaffold ID: JGI25319J35699_1000761
• Source Dataset Name: Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16119
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (4.55%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic

Source Dataset Sampling Location

• Location Name: Mt. Terri, Switzerland
• Coordinates
  • Lat. (^o): 47.379
  • Long. (^o): 7.1648
  • Depth (m): 562.73

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013050	Metagenome / Metatranscriptome	275	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25319J35699_10007615	F013050	AGG	MSKGKQPRTRVKVPKLLLSEIKDVFFKYNQEIGLEAAIF*