| Basic Information | |
|---|---|
| Taxon OID | 3300002516 Open in IMG/M |
| Scaffold ID | FJ528644_10000026 Open in IMG/M |
| Source Dataset Name | Host associated Microbial communities of an Orange Tunicate from Islas Murcielagos, Costa Rica -Sample 27904 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 59527 |
| Total Scaffold Genes | 71 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 26 (36.62%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Orange Tunicate → Orange Tunicate Microbial Communities From Islas Murcielagos, Costa Rica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Costa Rica | |||||||
| Coordinates | Lat. (o) | 10.854298 | Long. (o) | -85.931692 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055778 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FJ528644_1000002649 | F055778 | N/A | MLSKVDFPEPELPTIRTISPCSTDKVALSSAFTLFSSSP* |
| ⦗Top⦘ |