Scaffold D0C9_10112099

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold D0C9_10112099

Scaffold D0C9_10112099

Overview

Basic Information
Taxon OID	3300002512 Open in IMG/M
Scaffold ID	D0C9_10112099 Open in IMG/M
Source Dataset Name	Gut microbiomes of Pimephales promelas (fathead minnow) during Triclosan exposure experiment - D0C9- baseline
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1121
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fish → Digestive System → Intestine → Unclassified → Pimephales Promelas Gut → Pimephales Promelas Gut Microbial Communities From The University Of Colorado, Denver, Usa, During Triclosan Exposure Experiment

Source Dataset Sampling Location
Location Name	Denver, Colorado, USA
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-104.9847	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
D0C9_101120992	F077438	N/A	EEFSVTSLCCVYSTHRVERPFAQSRFETLFLWNLQVEISSDLMPTVEKEISSNKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.