NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TOLCLC_10040943

Scaffold TOLCLC_10040943


Overview

Basic Information
Taxon OID3300002498 Open in IMG/M
Scaffold IDTOLCLC_10040943 Open in IMG/M
Source Dataset NameHydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35068
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (90.62%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameNorthern Alberta, Canada
CoordinatesLat. (o)54.0Long. (o)-114.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032553Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
TOLCLC_1004094315F032553AGGGGGLERLAGVTVLSVDRSKHQARVRVEEGTTSPDQVVAAIQEAGRFQAKPA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.