| Basic Information | |
|---|---|
| Taxon OID | 3300002498 Open in IMG/M |
| Scaffold ID | TOLCLC_10003133 Open in IMG/M |
| Source Dataset Name | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1379 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salegentibacter → Salegentibacter salarius | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Northern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 54.0 | Long. (o) | -114.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030486 | Metagenome / Metatranscriptome | 185 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TOLCLC_100031331 | F030486 | N/A | ANVRRYVQLAQSRGGACFCTRGAMQDHADITLFSRWQKP* |
| ⦗Top⦘ |