Scaffold BRMGV_1104680

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BRMGV_1104680

Scaffold BRMGV_1104680

Overview

Basic Information
Taxon OID	3300002495 Open in IMG/M
Scaffold ID	BRMGV_1104680 Open in IMG/M
Source Dataset Name	454 Fosmid Sequence
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1130
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes

Source Dataset Sampling Location
Location Name	Bertioga - SP
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019895	Metagenome / Metatranscriptome	227	Y

Sequences

Protein ID	Family	RBS	Sequence
BRMGV_11046803	F019895	N/A	MQSQIENYRAKAKEFARLMIVAKSLRHSRQYRKLAEMYWALALGEESDRAEPSKTYVKRNAT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.