Scaffold JGI24020J35080_1016178

Overview

Basic Information

• Taxon OID: 3300002481
• Scaffold ID: JGI24020J35080_1016178
• Source Dataset Name: Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362A_J2.573
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1595
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid → Deep Subsurface And Oceanic Microbial Communities From Witwatersrand Basin, South Africa, And The Canadian And Fennoscandian Shields And At The Lost City Hydrothermal Field

Source Dataset Sampling Location

• Location Name: Juan de Fuca Ridge flank, Pacific Ocean
• Coordinates
  • Lat. (^o): 47.76
  • Long. (^o): -127.76
  • Depth (m): 454

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036104	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24020J35080_10161784	F036104	AGGAGG	MGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFASGGNLG