Scaffold JGI24209J29981_11637

Overview

Basic Information

• Taxon OID: 3300002340
• Scaffold ID: JGI24209J29981_11637
• Source Dataset Name: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - H_11min_Aerobic no depletion (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 574
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cenocepacia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location

• Location Name: Madison, WI, USA
• Coordinates
  • Lat. (^o): 43.078418
  • Long. (^o): -89.386482

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023044	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24209J29981_116371	F023044	N/A	FDFSAIFAQLQEVAAALAQQALGQVVGSLAGLIGGRASVDLAAIFNGFLADITGAVTGIGQHLLNQGLAAVLGGLGSLGGSRFLGDLLSSLSSQIGSAVTAAQGALSGALGSLGALGGNILDASKPHWEQLQEQLVGHGLNVLGSLSETINNLHGSITGGR*