| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002340 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055735 | Gp0057359 | Ga0004984 |
| Sample Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - H_11min_Aerobic no depletion (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1916174 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cenocepacia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Madison, WI, USA | |||||||
| Coordinates | Lat. (o) | 43.078418 | Long. (o) | -89.386482 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023044 | Metagenome / Metatranscriptome | 211 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24209J29981_11637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cenocepacia | 574 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24209J29981_11637 | JGI24209J29981_116371 | F023044 | FDFSAIFAQLQEVAAALAQQALGQVVGSLAGLIGGRASVDLAAIFNGFLADITGAVTGIGQHLLNQGLAAVLGGLGSLGGSRFLGDLLSSLSSQIGSAVTAAQGALSGALGSLGALGGNILDASKPHWEQLQEQLVGHGLNVLGSLSETINNLHGSITGGR* |
| ⦗Top⦘ |