NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold xDRAFT_10523556

Scaffold xDRAFT_10523556


Overview

Basic Information
Taxon OID3300002334 Open in IMG/M
Scaffold IDxDRAFT_10523556 Open in IMG/M
Source Dataset NameNorth Pond borehole 395A, 173 mbsf, polyester segment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)537
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Biofilm → Marine Biofilm Microbial Communities From The Mid-Atlantic, From A Ridge-Flank Borehole

Source Dataset Sampling Location
Location NameNorth Pond sediment pond, borehole 395A
CoordinatesLat. (o)22.755865Long. (o)-46.081015Alt. (m)Depth (m)4484
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096536Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
xDRAFT_105235562F096536N/ACDGDVDGDEQVNPVDSGLVQAAYGTADGSNLCQFDLDCNGVIDPIDTGIVQSLFGTCDPPRGGCP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.