Scaffold xDRAFT_10199211

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold xDRAFT_10199211

Scaffold xDRAFT_10199211

Overview

Basic Information
Taxon OID	3300002334 Open in IMG/M
Scaffold ID	xDRAFT_10199211 Open in IMG/M
Source Dataset Name	North Pond borehole 395A, 173 mbsf, polyester segment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	590
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Biofilm → Marine Biofilm Microbial Communities From The Mid-Atlantic, From A Ridge-Flank Borehole

Source Dataset Sampling Location
Location Name	North Pond sediment pond, borehole 395A
Coordinates	Lat. (^o)	22.755865	Long. (^o)	-46.081015	Alt. (m)		Depth (m)	4484
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096536	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
xDRAFT_101992111	F096536	N/A	HSFPTRRSSDLPVDSGLVQAAFGSSDEQDLCNYDIDCDGQINPVDSGIVQSLFGTCEAPRAACP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.