Basic Information | |
---|---|
Taxon OID | 3300002334 Open in IMG/M |
Scaffold ID | xDRAFT_10199211 Open in IMG/M |
Source Dataset Name | North Pond borehole 395A, 173 mbsf, polyester segment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 590 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Biofilm → Marine Biofilm Microbial Communities From The Mid-Atlantic, From A Ridge-Flank Borehole |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond sediment pond, borehole 395A | |||||||
Coordinates | Lat. (o) | 22.755865 | Long. (o) | -46.081015 | Alt. (m) | Depth (m) | 4484 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096536 | Metagenome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
xDRAFT_101992111 | F096536 | N/A | HSFPTRRSSDLPVDSGLVQAAFGSSDEQDLCNYDIDCDGQINPVDSGIVQSLFGTCEAPRAACP* |
⦗Top⦘ |