Basic Information | |
---|---|
Taxon OID | 3300002228 Open in IMG/M |
Scaffold ID | S2T7FKBa104N_1288969 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea - S2t7 FKBa (104N) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Karolinska Institutet |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1190 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.0745 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104759 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
S2T7FKBa104N_12889694 | F104759 | N/A | MACKFLEDSKGNKSSKRLWGSILLTIGIVFSSILFFYSLKAGAKDAATALGIINMFLISGGGLLGIGVFEKVIKK* |
⦗Top⦘ |