| Basic Information | |
|---|---|
| Taxon OID | 3300002227 Open in IMG/M |
| Scaffold ID | M1t6FKB1101N_1141811 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Baltic Sea - M1t6 FKB1 (101N) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Karolinska Institutet |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12894 |
| Total Scaffold Genes | 21 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (90.48%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 58.133 | Long. (o) | 10.0 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018082 | Metagenome / Metatranscriptome | 237 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| M1t6FKB1101N_114181119 | F018082 | GGA | MKKVLVVGFKVHTSIGKLVKGDTAELPNAEVQTLVRVRPDALKVLGNVEPAPAPAPIKRAKSK* |
| ⦗Top⦘ |