Scaffold M1t6FKB2_1610108

Overview

Basic Information

• Taxon OID: 3300002226
• Scaffold ID: M1t6FKB2_1610108
• Source Dataset Name: Marine microbial communities from the Baltic Sea - M1t6 FKB2 (106N)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Karolinska Institutet
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2836
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.133
  • Long. (^o): 10.0
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034571	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
M1t6FKB2_16101082	F034571	AGGAG	MSREHFHESQIEDKVEKYMQEGMSDEDAIQKAESEYHGQVNLVEDQALKINKRQVAFQKALRQGCYPSEIVLAMVVDHLQASYNSDSESTVVKEFCRELLTKINDDTLEVANAE*