Scaffold M1t6BS2105N_1398571

Overview

Basic Information

• Taxon OID: 3300002224
• Scaffold ID: M1t6BS2105N_1398571
• Source Dataset Name: Marine microbial communities from the Baltic Sea - M1t6 BS2 (105N)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Karolinska Institutet
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.133
  • Long. (^o): 10.0
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061041	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
M1t6BS2105N_13985711	F061041	N/A	NLVLGINQNPLVMEDLVHHQEMERKKVSVTKENLVLQKRITRNQQDSQIIQNTLEKKHLKVHLLVERKKALVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF*