Basic Information | |
---|---|
Taxon OID | 3300002184 Open in IMG/M |
Scaffold ID | JGI24770J26754_10023372 Open in IMG/M |
Source Dataset Name | Freshwater and sediment microbial communities from Lake Erie, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3206 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erie, Canada | |||||||
Coordinates | Lat. (o) | 42.285437 | Long. (o) | -81.355591 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021521 | Metagenome / Metatranscriptome | 218 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24770J26754_100233722 | F021521 | N/A | MAGYLHRAATTAYLAAFLPWEGSAGAGRVRPAAANIGQKVFYKK* |
⦗Top⦘ |