| Basic Information | |
|---|---|
| Taxon OID | 3300002169 Open in IMG/M |
| Scaffold ID | JGIcombinedJ26738_114637 Open in IMG/M |
| Source Dataset Name | floor swab of Spacecraft Assembly Facility - replicate A (Combined floor swab M2426|M2425|M2424|M2423|M2428|M2427, ASSEMBLY_DATE=20140108) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 549 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | NASA Jet Propulsion Laboratory, Pasadena, California, USA | |||||||
| Coordinates | Lat. (o) | 34.1991 | Long. (o) | -118.1715 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033665 | Metagenome / Metatranscriptome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGIcombinedJ26738_1146372 | F033665 | N/A | MLICGSIGCALAIKIGGEAKTHEISKTQKWSGQILLGLEDIKIINIFNGVPKSKRRKNKILMGINIKLG* |
| ⦗Top⦘ |