Scaffold JGI24540J26637_10003420

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24540J26637_10003420

Scaffold JGI24540J26637_10003420

Overview

Basic Information
Taxon OID	3300002153 Open in IMG/M
Scaffold ID	JGI24540J26637_10003420 Open in IMG/M
Source Dataset Name	Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7122
Total Scaffold Genes	26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (15.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Norwegian Sea, Atlantic Ocean
Coordinates	Lat. (^o)	73.0188	Long. (^o)	9.8566	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098052	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24540J26637_100034203	F098052	N/A	MEKQNGIYRFKYTELINNNERESELVIETKDVVRSIGKFGETRQLTDLNVKQLNKR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.