Scaffold JGI24036J26619_10064530

Overview

Basic Information

• Taxon OID: 3300002128
• Scaffold ID: JGI24036J26619_10064530
• Source Dataset Name: Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046248	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24036J26619_100645302	F046248	N/A	MXKKYSLRRTLPIFVAAVLLTAIFVDVVAAGVKAVSRGSRASYPASGGAITISVPNAMKPFPAELLPQ*