Scaffold JGI24808J26613_1010231

Overview

Basic Information

• Taxon OID: 3300002099
• Scaffold ID: JGI24808J26613_1010231
• Source Dataset Name: Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1889
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location

• Location Name: Manhattan, Kansas, USA
• Coordinates
  • Lat. (^o): 39.214
  • Long. (^o): -96.5852
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094028	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24808J26613_10102312	F094028	GAGG	LPVCLKLPSCKREKDLSNNYRFNTSVTYRHHFDPDIVDQKYDRGGGKAVQ*