NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094028

Metagenome Family F094028

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094028
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 54 residues
Representative Sequence MFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Number of Associated Samples 88
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.04 %
% of genes near scaffold ends (potentially truncated) 47.17 %
% of genes from short scaffolds (< 2000 bps) 86.79 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.321 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.472 % of family members)
Environment Ontology (ENVO) Unclassified
(35.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.679 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.23%    β-sheet: 0.00%    Coil/Unstructured: 92.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF02622DUF179 35.85
PF00512HisKA 13.21
PF02518HATPase_c 7.55
PF06283ThuA 6.60
PF02547Queuosine_synth 3.77
PF15071TMEM220 0.94
PF07995GSDH 0.94
PF13287Fn3_assoc 0.94
PF02823ATP-synt_DE_N 0.94
PF02381MraZ 0.94
PF13380CoA_binding_2 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1678Putative transcriptional regulator, AlgH/UPF0301 familyTranscription [K] 35.85
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 6.60
COG0809S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)Translation, ribosomal structure and biogenesis [J] 3.77
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.94
COG2001MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activityTranslation, ribosomal structure and biogenesis [J] 0.94
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.32 %
UnclassifiedrootN/A38.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1378522Not Available544Open in IMG/M
3300000956|JGI10216J12902_100761844Not Available781Open in IMG/M
3300002099|JGI24808J26613_1004843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3565Open in IMG/M
3300002099|JGI24808J26613_1010231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1889Open in IMG/M
3300004156|Ga0062589_101456835Not Available671Open in IMG/M
3300004157|Ga0062590_102108408Not Available588Open in IMG/M
3300004463|Ga0063356_103140312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium712Open in IMG/M
3300005183|Ga0068993_10043904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1273Open in IMG/M
3300005289|Ga0065704_10302045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium883Open in IMG/M
3300005290|Ga0065712_10019915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2135Open in IMG/M
3300005290|Ga0065712_10560145Not Available612Open in IMG/M
3300005294|Ga0065705_10677370Not Available664Open in IMG/M
3300005333|Ga0070677_10217891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium930Open in IMG/M
3300005334|Ga0068869_100057055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2849Open in IMG/M
3300005335|Ga0070666_10988732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes624Open in IMG/M
3300005355|Ga0070671_100426024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1137Open in IMG/M
3300005355|Ga0070671_102040128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes511Open in IMG/M
3300005356|Ga0070674_100688690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes873Open in IMG/M
3300005364|Ga0070673_101525011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales631Open in IMG/M
3300005444|Ga0070694_100896805Not Available732Open in IMG/M
3300005467|Ga0070706_101992171Not Available526Open in IMG/M
3300005539|Ga0068853_100197966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1828Open in IMG/M
3300005566|Ga0066693_10261551Not Available686Open in IMG/M
3300005577|Ga0068857_100289491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1508Open in IMG/M
3300005615|Ga0070702_100427628Not Available955Open in IMG/M
3300005617|Ga0068859_100350742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1570Open in IMG/M
3300005617|Ga0068859_101463863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium754Open in IMG/M
3300005618|Ga0068864_100255433All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1628Open in IMG/M
3300006046|Ga0066652_100618424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1024Open in IMG/M
3300006237|Ga0097621_100725405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium917Open in IMG/M
3300006844|Ga0075428_101794335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes639Open in IMG/M
3300006845|Ga0075421_100681615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1197Open in IMG/M
3300009094|Ga0111539_12234435Not Available635Open in IMG/M
3300009100|Ga0075418_10182917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2231Open in IMG/M
3300010403|Ga0134123_11604191Not Available698Open in IMG/M
3300011423|Ga0137436_1202989Not Available522Open in IMG/M
3300012469|Ga0150984_100731733Not Available551Open in IMG/M
3300012892|Ga0157294_10275514Not Available528Open in IMG/M
3300012893|Ga0157284_10103682Not Available747Open in IMG/M
3300012895|Ga0157309_10028465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1275Open in IMG/M
3300012895|Ga0157309_10087674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium841Open in IMG/M
3300012896|Ga0157303_10062647Not Available801Open in IMG/M
3300012896|Ga0157303_10116370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium671Open in IMG/M
3300012898|Ga0157293_10108010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium728Open in IMG/M
3300012898|Ga0157293_10139725All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium672Open in IMG/M
3300012900|Ga0157292_10403266Not Available518Open in IMG/M
3300012907|Ga0157283_10157344Not Available676Open in IMG/M
3300012910|Ga0157308_10173368Not Available707Open in IMG/M
3300012914|Ga0157297_10005230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2531Open in IMG/M
3300012915|Ga0157302_10345909Not Available594Open in IMG/M
3300013306|Ga0163162_10956805Not Available967Open in IMG/M
3300014326|Ga0157380_10557962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1125Open in IMG/M
3300015200|Ga0173480_10384295Not Available810Open in IMG/M
3300015371|Ga0132258_13188982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter solisilvae1132Open in IMG/M
3300015374|Ga0132255_105597203Not Available532Open in IMG/M
3300018081|Ga0184625_10466385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4645Open in IMG/M
3300018084|Ga0184629_10664496Not Available527Open in IMG/M
3300018469|Ga0190270_10025937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3725Open in IMG/M
3300018476|Ga0190274_10005441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter ginsengisoli7644Open in IMG/M
3300018476|Ga0190274_10234409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1649Open in IMG/M
3300018476|Ga0190274_11466523Not Available773Open in IMG/M
3300019361|Ga0173482_10541221Not Available573Open in IMG/M
3300019362|Ga0173479_10040734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1469Open in IMG/M
3300019362|Ga0173479_10880791Not Available504Open in IMG/M
3300020000|Ga0193692_1015834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1821Open in IMG/M
3300020000|Ga0193692_1080881Not Available708Open in IMG/M
3300020005|Ga0193697_1002013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5551Open in IMG/M
3300020020|Ga0193738_1000216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae40511Open in IMG/M
3300021415|Ga0193694_1000002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1397013Open in IMG/M
3300022756|Ga0222622_10568534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium816Open in IMG/M
3300022756|Ga0222622_10591934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium800Open in IMG/M
3300022756|Ga0222622_10845696Not Available669Open in IMG/M
3300022886|Ga0247746_1006000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2376Open in IMG/M
3300022899|Ga0247795_1006324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1905Open in IMG/M
3300022899|Ga0247795_1007086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1795Open in IMG/M
3300022917|Ga0247777_1226734Not Available602Open in IMG/M
3300023062|Ga0247791_1026369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes881Open in IMG/M
3300023066|Ga0247793_1093538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4522Open in IMG/M
3300023077|Ga0247802_1015797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1030Open in IMG/M
3300023078|Ga0247756_1119345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes522Open in IMG/M
3300023260|Ga0247798_1031809Not Available691Open in IMG/M
3300023264|Ga0247772_1031788All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1077Open in IMG/M
3300024055|Ga0247794_10008049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2379Open in IMG/M
3300024055|Ga0247794_10147375Not Available733Open in IMG/M
3300025580|Ga0210138_1086543Not Available750Open in IMG/M
3300025923|Ga0207681_10904271Not Available739Open in IMG/M
3300025930|Ga0207701_10277670All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1458Open in IMG/M
3300025934|Ga0207686_10274628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1241Open in IMG/M
3300025961|Ga0207712_10013154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5303Open in IMG/M
3300025961|Ga0207712_10627981Not Available932Open in IMG/M
3300026088|Ga0207641_10188736All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1893Open in IMG/M
3300027526|Ga0209968_1019853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1084Open in IMG/M
3300031538|Ga0310888_10240262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1012Open in IMG/M
3300031538|Ga0310888_10801324Not Available583Open in IMG/M
3300031547|Ga0310887_10155061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1205Open in IMG/M
3300031562|Ga0310886_10605979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4673Open in IMG/M
3300031854|Ga0310904_10577098Not Available765Open in IMG/M
3300031858|Ga0310892_10051204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2049Open in IMG/M
3300031858|Ga0310892_10581593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4756Open in IMG/M
3300031892|Ga0310893_10562462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes518Open in IMG/M
3300031908|Ga0310900_11385832Not Available590Open in IMG/M
3300031944|Ga0310884_10494335Not Available717Open in IMG/M
3300032157|Ga0315912_10274250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1328Open in IMG/M
3300032179|Ga0310889_10209310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium905Open in IMG/M
3300032205|Ga0307472_101730747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes619Open in IMG/M
3300032211|Ga0310896_10317817Not Available810Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_137852213300000881SoilLPVCLKLPSSKREKDFSNNYCINTPVTYRHHFDPNIVDQEYDR
JGI10216J12902_10076184413300000956SoilMVEVLSLPDCLKLPSCKREKDFSNNYSVDPCVPHRHYPDPDILDQKHDRGGGKAV*
JGI24808J26613_100484313300002099SoilMFEVLSLPDCLKLPSCKREKDFSNNYCSNTCVPYRHHFDPDIMDQKYDRGGGKAV*
JGI24808J26613_101023123300002099SoilLPVCLKLPSCKREKDLSNNYRFNTSVTYRHHFDPDIVDQKYDRGGGKAVQ*
Ga0062589_10145683523300004156SoilMFEVLSLPDCFKLPSCKREKDFSNNYSLNTCVAYRHYFDPDIMDQKYDRSGGEAV*
Ga0062590_10210840823300004157SoilMFEVLSLRDCLKLPSCKREKDFSNNYCPNTCVTYRHHFDPDIMDQKYDRGGGK
Ga0063356_10314031213300004463Arabidopsis Thaliana RhizosphereLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAVHRKDYGSNKDGG*
Ga0068993_1004390423300005183Natural And Restored WetlandsMFEVLSLPDCLKLPSCKREKDFSNNYSFNTCVTHRHHFDSDIMDQKYDCGGGKAV*
Ga0065704_1030204523300005289Switchgrass RhizosphereVLSLPDCLKLPSCKREKDFSNNYCLNSSVPHWHHFDPNILDKKYDRGGGKAV*
Ga0065712_1001991533300005290Miscanthus RhizosphereMFEVLSLPDCSKLPSCKREKDFSNNYRLNTCVTYRHHFDPDIMDKKYDRGGGKTVQ*
Ga0065712_1056014513300005290Miscanthus RhizosphereLKLPSCKREKDFSNNYRLNTCVTHRHHFDPNIMDQKYDRCGGKAVH*
Ga0065705_1067737013300005294Switchgrass RhizosphereSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFNPDIMDQKYDRCRGKAVH*
Ga0070677_1021789113300005333Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAVH*
Ga0068869_10005705533300005334Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYCFNTCVPHRHHFDPDIMDQKYDRGGGKAVQ*
Ga0070666_1098873213300005335Switchgrass RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKTVQRKSNSCYNNCRRGII*
Ga0070671_10042602423300005355Switchgrass RhizosphereLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKHDRRGGKSV*
Ga0070671_10204012823300005355Switchgrass RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQK
Ga0070674_10068869023300005356Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKTVQ*
Ga0070673_10152501123300005364Switchgrass RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKHDRRGGKSV*
Ga0070694_10089680523300005444Corn, Switchgrass And Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV*
Ga0070706_10199217123300005467Corn, Switchgrass And Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKSV*
Ga0068853_10019796623300005539Corn RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAVH*
Ga0066693_1026155123300005566SoilMFEVLSLPDCLKLPSCKCEKDLSDNYRLNTCVTHRHYFDPDIMDQEYDRG*
Ga0068857_10028949123300005577Corn RhizosphereMFEVLSLPDCLKLPSCKCEKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAVQ*
Ga0070702_10042762813300005615Corn, Switchgrass And Miscanthus RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPNIMDQKYDRRGRKAVQRKSNSSHNNCWRRI
Ga0068859_10035074223300005617Switchgrass RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAVH*
Ga0068859_10146386323300005617Switchgrass RhizosphereVLSLPDCLKLPSCKREKDFSNNYCFNTCVPHRHHFDPDIMDQKYDRGGGKAVQ*
Ga0068864_10025543323300005618Switchgrass RhizosphereMFEVLSLPDCVKLPSCKREKDFSNNYCLNTCVTHWHHFDPDIVDQKYDRSGGKAV*
Ga0066652_10061842413300006046SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHWHHFDSNIMDQKYDRGGGKAVQ*
Ga0097621_10072540513300006237Miscanthus RhizosphereDCLKLPSCKREKDLSDNYRLNTCVTHRHYFDPNIMDQKHDRCRGKTV*
Ga0075428_10179433523300006844Populus RhizosphereMFEVLSLPDCLKLPSCKREKDFSNNYCPNTSVTYRHYFDPDIMDQKHDRSGGKAV*
Ga0075421_10068161533300006845Populus RhizosphereLPVCLKLPSCKREKDFSNNYRFNITVTHRHHFDPNIVDQKYDRGGG
Ga0111539_1223443513300009094Populus RhizosphereVCLKLPSSKREKDFSNNYCINTPVTYRHHFDPNIVDQEYDRGGGKTVQRKSNSGHKDGG*
Ga0075418_1018291713300009100Populus RhizosphereMIEVLSLPVCLKLPSCKREKDFSNNYRFNITVTHRHHFDPNIVDQKYDRGGGKAVQ*
Ga0134123_1160419113300010403Terrestrial SoilMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCRGKA
Ga0137436_120298913300011423SoilDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKSV*
Ga0150984_10073173323300012469Avena Fatua RhizosphereLPSCKCEKDLSDNYRLNTCVTHWHYFDPDIVDQEYDRG*
Ga0157294_1027551413300012892SoilLSLPVCLKLPSCKREKDLSDNYRLNTCFSHRHHFDPNIMDQKYDRGGRKAVQ*
Ga0157284_1010368213300012893SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRCGGKA
Ga0157309_1002846513300012895SoilRMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGEAV*
Ga0157309_1008767423300012895SoilRMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPNIMDQKYDRGGRKAVQ*
Ga0157303_1006264723300012896SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQK
Ga0157303_1011637023300012896SoilCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGGKAV*
Ga0157293_1010801023300012898SoilPSALKLPSCKREKDFSDNYRLNTCVTHRHHFDPDFMDQKYDRGGRKAV*
Ga0157293_1013972513300012898SoilCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGRKAVQ*
Ga0157292_1040326623300012900SoilVCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGGKAV*
Ga0157283_1015734413300012907SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAV
Ga0157308_1017336823300012910SoilLPVCLKLPSGKREKDFSNNYSLNTIVTYRHHFDPDIVDQKYDRGRGKAV*
Ga0157297_1000523033300012914SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGRKAVQ*
Ga0157302_1034590913300012915SoilMFEVLSLPVCLKLPSRKREKDLSDKYRLNTCVSHRHHFDPNIMDQKYDRGGGKAV*
Ga0163162_1095680513300013306Switchgrass RhizosphereMFEVLSLPDCLKLPSCKCEKDLADNYRLNTCVTHRHHFDPDIMDQKYDRCGGKTI
Ga0157380_1055796213300014326Switchgrass RhizosphereDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKTVQ*
Ga0173480_1038429513300015200SoilLFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPNIMDQKYDRRGRKAVQRK
Ga0132258_1318898223300015371Arabidopsis RhizosphereMFEVLSLPVCLKLPSCKREKDFSNNYSFNTRVTHWHHFDPDIVDQEYDRGGGKAV*
Ga0132255_10559720313300015374Arabidopsis RhizosphereDGKRMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHYFDPNIMDQKHDRCRGKTV*
Ga0184625_1046638523300018081Groundwater SedimentMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKTVQ
Ga0184629_1066449613300018084Groundwater SedimentMFEVLSLPVCLKLPSCKREKDFPDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKTVQ
Ga0190270_1002593723300018469SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVTNRHHFDPNIMDQKYDRGGGKTV
Ga0190274_1000544143300018476SoilMFEVLSLPVCLKLPSCKREKDFSDNYRLNTCVTHRHHFDPNIMDQKYDRCGGKAVQ
Ga0190274_1023440923300018476SoilMFEVLSLPVCLKLPSCKREKDFSNNYCFNTCVTHRHRFDPNIMDQKYDRGGGKSV
Ga0190274_1146652323300018476SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDILDQKYDHSGGKAVHRKSH
Ga0173482_1054122113300019361SoilMFEVLSLPDCLKLPSCKREKDLSNNYRLNTFVTHWHYFDPNILDQKHDRSVGKAVQRKSYSRHHNCWR
Ga0173479_1004073413300019362SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGRKAVQ
Ga0173479_1088079123300019362SoilLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDKKYDRGGGKTVQ
Ga0193692_101583433300020000SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKPVQGKSYDSNKNGGGRVI
Ga0193692_108088123300020000SoilMIEVLSLPDCLKLPSCKREKDFSNNYCLNTCVTYRHHPDPNIMDQKYD
Ga0193697_100201363300020005SoilMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCRGKAFQRKCN
Ga0193738_1000216233300020020SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIVDQKYDRGGGKAV
Ga0193694_10000021533300021415SoilMFEVLSLPICLKLPSCKREKDFSDNYRLNTCVTHRHHFDPDIMDQKYDHSGGKAVHRKSHGSNKNGR
Ga0222622_1056853413300022756Groundwater SedimentVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAVH
Ga0222622_1059193423300022756Groundwater SedimentSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDKKYDRGGGKTVQ
Ga0222622_1084569613300022756Groundwater SedimentMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFNPDIMDQKYDRC
Ga0247746_100600033300022886SoilLPSFKREKDFSNNYCPNTCVTYRHHFDPDIMDQKYDRGGGKAV
Ga0247795_100632423300022899SoilMFEVLSLPDCFKLPSCKREKDFSNNYSLNTCVAYRHYFDPDIMDQKYDRSGGEAV
Ga0247795_100708633300022899SoilMFEVLSLRDCLKLPSCKREKDFSNNYCPNTCVTYRHHFDPDIMDQKYDRGGGKAV
Ga0247777_122673413300022917Plant LitterCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGGKAV
Ga0247791_102636923300023062SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGGKAVQ
Ga0247793_109353823300023066SoilMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHWHHFDPNIMDQKYDRGGRKAVQ
Ga0247802_101579713300023077SoilMFEVLSLRDCLKLPSCKREKDFSNNYCPNTCVTYRHHFDPDIMDQKYDRGRGKAV
Ga0247756_111934523300023078Plant LitterMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFNPDIMDQKYDR
Ga0247798_103180913300023260SoilMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVSHRHHFDPNIMDQKYDRGGRKAVQ
Ga0247772_103178813300023264Plant LitterMFEVLSLPVCLKLPSCKREKDLSDNYRLNTCVSHWHHFDPNIMDQKYDRGGRKTVQ
Ga0247794_1000804933300024055SoilMFEVLSLPDCFKLPSCKREKDFSNNYSLNTCVTYRHYFDPDIMDQKYDRGGGKAV
Ga0247794_1014737513300024055SoilMFEVLSLRDCLKLPSCKREKDFSNNYCPNTCVTYRHHFDPDIMDQKYDR
Ga0210138_108654313300025580Natural And Restored WetlandsMFEVLSLPDCLKLPSCKREKDFSNNYSFNTCVTHRHHFDSDIMDQKYDCGGGKAV
Ga0207681_1090427123300025923Switchgrass RhizosphereMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCRG
Ga0207701_1027767013300025930Corn, Switchgrass And Miscanthus RhizospherePDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCRGKAFQRKCN
Ga0207686_1027462813300025934Miscanthus RhizosphereVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHYFDPNIMDQKHDRCRGKTV
Ga0207712_1001315433300025961Switchgrass RhizosphereMVEVLSLPDCLKLPSCKREKDFSNNYSLNSSVTHRHHFDPNIMDKKYDRR
Ga0207712_1062798123300025961Switchgrass RhizosphereMFEVLSLPDCVKLPSCKREKDFSNNYCLNTCVTHWHHFDPDIVDQKYDRSGGKAV
Ga0207641_1018873623300026088Switchgrass RhizosphereMFEVLSLPDCVKLPSCKREKDFSNNYCLNTCVTHWHHFDPDIVDQKYDRGGGKAV
Ga0209968_101985313300027526Arabidopsis Thaliana RhizosphereMFEVLSLPVCLKLPSCKREKDFSNNYCINTSVTHRHHFDPNIVDQKYDRGGRKAV
Ga0310888_1024026223300031538SoilSKRMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Ga0310888_1080132423300031538SoilMFEVLSLPDCLKLPSCKREKDLSNNYCPNTCVTYRHHFDPDILDQKHDCRGGKAV
Ga0310887_1015506123300031547SoilMFEVLSLPDCLKLPSCKREKDFSNNYSFNTRVAHRHHFDPDIVDQKYDRGGRKAV
Ga0310886_1060597923300031562SoilMFEVLSLPDCLKLPSCKREKDFSNNYCPNTSVTYRHYFDPDIMDQKHDRSGGKAV
Ga0310904_1057709823300031854SoilMFEVLSLPDCLKLPSCKREKDFSNNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Ga0310892_1005120423300031858SoilMIEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Ga0310892_1058159323300031858SoilMFEVLSLPDCLKLPSCKREKDLSNNYSVDPCVPHRHYPDPNILDQKHDRGGGKAV
Ga0310893_1056246213300031892SoilMFEVLSLPDCVKLPSCKREKDFSNNYCLNTCVTHWHHFDPDIVDQK
Ga0310900_1138583223300031908SoilRMFEVLSLPDCLKLPSCKREKDLSNNYSVDPCVPHRHYPDPNILDQKHDRGGGKAV
Ga0310884_1049433523300031944SoilMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Ga0315912_1027425013300032157SoilLPVCLKLPSCKREKDFSNNYSLNTIVTYRHHFDPNIVDQKYDRGGGKAVQRKNN
Ga0310889_1020931013300032179SoilKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRGGGKAV
Ga0307472_10173074723300032205Hardwood Forest SoilMFEVLSLPVCLKLPSCKREKDFSDNYSLNTCVTHRHHFDPDILDQKYDRGGGKAV
Ga0310896_1031781713300032211SoilMFEVLSLPDCLKLPSCKREKDLSDNYRLNTCVTHRHHFDPDIMDQKYDRCGGKAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.