| Basic Information | |
|---|---|
| Taxon OID | 3300002053 Open in IMG/M |
| Scaffold ID | SMTZ23_10017259 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11465 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (93.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River estuary, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 34.6478111 | Long. (o) | -77.1112083 | Alt. (m) | Depth (m) | .24 to .32 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080858 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SMTZ23_1001725913 | F080858 | AGGAG | MARFEEFREALGQILQERPNCYWLGYQIVEMLRERNPEILEGLEKKFATSYGRGGGDYYSTDSAIAHCLQDWPERVDVQYLLGRDLQIGNVKASDEAITIYRWIG* |
| ⦗Top⦘ |