Scaffold smpD1_1007430

Overview

Basic Information

• Taxon OID: 3300002025
• Scaffold ID: smpD1_1007430
• Source Dataset Name: Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1149
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil → Permafrost And Active Layer Soil Microbial Communities From Mcgill Arctic Research Station (Mars), Canada, For Enrichment Studies

Source Dataset Sampling Location

• Location Name: Axel Heiberg Island, Nunavut, Canada
• Coordinates
  • Lat. (^o): 79.26
  • Long. (^o): -90.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082269	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
smpD1_10074302	F082269	AGGAGG	MECDICGQNVENSEDLQKHKERAHPTGMGDKSIDNLEKPDLLGDTPEESATSEMPKATH*