Basic Information | |
---|---|
Taxon OID | 3300002023 Open in IMG/M |
Scaffold ID | plot21A_1008755 Open in IMG/M |
Source Dataset Name | Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot21A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Knoxville, Tennessee, USA | |||||||
Coordinates | Lat. (o) | 35.9728 | Long. (o) | -83.9422 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059695 | Metagenome / Metatranscriptome | 133 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
plot21A_10087552 | F059695 | N/A | VLARLKGPFDVVPQLAYSKTIAKSDKKPSRHFIRSEAFVNEKVIYRKGPSNRANKVLEVGLWVSYIFGLKQKI* |
⦗Top⦘ |