Scaffold plot12_101557

Overview

Basic Information

• Taxon OID: 3300001983
• Scaffold ID: plot12_101557
• Source Dataset Name: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa

Source Dataset Sampling Location

• Location Name: Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9728
  • Long. (^o): -83.9422

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033179	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
plot12_1015571	F033179	N/A	LDRSSAASDVYKRQQHIACGERVTTTHAEIVQAARNLHDQIRHAGFRQAQDIFDNPTPFHPGNDVFYDHACTGDEVIEEPVCYAQLLAFGVFLAAA*