x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300001983
3300001983: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-2
Overview
| Basic Information |
| IMG/M Taxon OID | 3300001983 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0103013 | Gp0060287 | Ga0016867 |
| Sample Name | Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 7661742 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | grassland biome → land → bulk soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information |
| Location | Knoxville, Tennessee, USA |
| Coordinates | Lat. (o) | 35.9728 | Long. (o) | -83.9422 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F033179 | Metagenome / Metatranscriptome | 178 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| plot12_101557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 538 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| plot12_101557 | plot12_1015571 | F033179 | LDRSSAASDVYKRQQHIACGERVTTTHAEIVQAARNLHDQIRHAGFRQAQDIFDNPTPFHPGNDVFYDHACTGDEVIEEPVCYAQLLAFGVFLAAA* |
