Scaffold GOS2253_10200

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2253_10200

Scaffold GOS2253_10200

Overview

Basic Information
Taxon OID	3300001923 Open in IMG/M
Scaffold ID	GOS2253_10200 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Tropical South Pacific Ocean - GS038
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	893
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	South Pacific Ocean
Coordinates	Lat. (^o)	-2.5819445	Long. (^o)	-97.85139	Alt. (m)		Depth (m)	1.8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004453	Metagenome	437	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2253_102003	F004453	N/A	MLIDFTEFELETIAAAMDDYIQYDDENISKEDLIGGLSVSDRVESILTKIDNVIMQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.