Scaffold FAAS_10769846

Overview

Basic Information

• Taxon OID: 3300001880
• Scaffold ID: FAAS_10769846
• Source Dataset Name: Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 517
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Hindgut → Unclassified → Termite Hindgut → Termite Hindgut Microbial Communities From The Max Planck Institute, Bremen, Germany, Analyzing Fibers In The Hindgut Lumen

Source Dataset Sampling Location

• Location Name: Max Planck Institute, Bremen, Germany
• Coordinates
  • Lat. (^o): 53.109695
  • Long. (^o): 8.847543

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074132	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
FAAS_107698462	F074132	AGG	VHHRTIQINHQPDATIFQFIILTFIYSSTCFGRFPAHHQELNDCSG