| Basic Information | |
|---|---|
| Taxon OID | 3300001880 Open in IMG/M |
| Scaffold ID | FAAS_10263996 Open in IMG/M |
| Source Dataset Name | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 515 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Hindgut → Unclassified → Termite Hindgut → Termite Hindgut Microbial Communities From The Max Planck Institute, Bremen, Germany, Analyzing Fibers In The Hindgut Lumen |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Max Planck Institute, Bremen, Germany | |||||||
| Coordinates | Lat. (o) | 53.109695 | Long. (o) | 8.847543 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005256 | Metagenome | 407 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FAAS_102639962 | F005256 | N/A | MEHPFLMFLDQQNDAAQSVGLLWTSDQLVAETSPDNTRHSQQTN |
| ⦗Top⦘ |