Scaffold ACM53_10013

Overview

Basic Information

• Taxon OID: 3300001852
• Scaffold ID: ACM53_10013
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM53, ROCA_DNA120_0.2um_25g
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1049
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 11.3123
  • Long. (^o): -56.4267

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037707	Metagenome / Metatranscriptome	167	N

Sequences

Protein ID	Family	RBS	Sequence
ACM53_100132	F037707	N/A	MLMTRYKDLSKRSVNTVIMEKIVDRLASGETLVDITKDKAMPSYRAVTRAVAADEDLWALYRKGRILQAEFYADKINGLAMEPLPEGDVRFLNAEVNRRRLEIDTLKWTTARNQPFGIRDKKEDQPQAQTFTISWSGGDTAINAHEDEEVLH*