NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001852

3300001852: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM53, ROCA_DNA120_0.2um_25g



Overview

Basic Information
IMG/M Taxon OID3300001852 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0096913 | Gp0056140 | Ga0016848
Sample NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM53, ROCA_DNA120_0.2um_25g
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1382658
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomeplume frontplanktonic material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAmazon River plume to Atlantic Ocean
CoordinatesLat. (o)11.3123Long. (o)-56.4267Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037707Metagenome / Metatranscriptome167N
F044540Metagenome / Metatranscriptome154Y
F063602Metagenome / Metatranscriptome129Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
ACM53_10013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1049Open in IMG/M
ACM53_10213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1181Open in IMG/M
ACM53_12334Not Available626Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
ACM53_10013ACM53_100132F037707MLMTRYKDLSKRSVNTVIMEKIVDRLASGETLVDITKDKAMPSYRAVTRAVAADEDLWALYRKGRILQAEFYADKINGLAMEPLPEGDVRFLNAEVNRRRLEIDTLKWTTARNQPFGIRDKKEDQPQAQTFTISWSGGDTAINAHEDEEVLH*
ACM53_10213ACM53_102134F063602MKVNIGLAFAMAVQLVALVWYISGLVHDLEHLKQTVSAQDELIRLIDQ
ACM53_12334ACM53_123341F044540MNATIINGATETKADADKLHQGVTDEFNATILTGNNCTSVNVKIKAKKKSIHPKIMQNIPATIKPGIEFGKTTFKNA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.