Scaffold ACM25_101107

Overview

Basic Information

• Taxon OID: 3300001823
• Scaffold ID: ACM25_101107
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM25, ROCA_DNA015_2.0um_2o
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 705
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 10.2885
  • Long. (^o): -54.512

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033052	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM25_1011072	F033052	N/A	ANILIFINATLFYIFVFGREIKALARLNKMEKILLRVGLSIPSMGALYNVLVGQYPPIPEIIINVGYASLWTWASIFHYNTFVKNGK*