Scaffold ACM41_104574

Overview

Basic Information

• Taxon OID: 3300001816
• Scaffold ID: ACM41_104574
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM41, ROCA_DNA031_2.0um_3k
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 7.2875
  • Long. (^o): -53.0005

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005505	Metagenome / Metatranscriptome	398	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM41_1045742	F005505	N/A	NYFFFER*NISELDEVRFYGVAPH*YFRPLMGILVISPTHYEGLM*MGLFFILLAFLPIFYNFYNVYHKYVATIPMQNSLLQTSFFIFFMMSLYCTASMLPCGRYYYEPEGGYVGNP*VKFSYQFVYLYLG*FVHHLDLFDHYIFQFSQTFVRKCSSYSLRTLVLRKEAAKKTNSRTAFAK**