Scaffold ACM41_100628

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACM41_100628

Scaffold ACM41_100628

Overview

Basic Information
Taxon OID	3300001816 Open in IMG/M
Scaffold ID	ACM41_100628 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM41, ROCA_DNA031_2.0um_3k
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	786
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon River plume to Atlantic Ocean
Coordinates	Lat. (^o)	7.2875	Long. (^o)	-53.0005	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005478	Metagenome / Metatranscriptome	399	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM41_1006282	F005478	GAG	MLQYIQNLDELMYDDYDLDYTFGNDYNLDEDTYYEYHAQLDAQDLDEEYTRDAHDYDTLAYRHYAYNLAHPYAIARHVCH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.