| Basic Information | |
|---|---|
| Taxon OID | 3300001806 Open in IMG/M |
| Scaffold ID | JGI20216J20342_1018767 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1498 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Twitchell Island, Sacramento and San Joaquin Delta, California, USA | |||||||
| Coordinates | Lat. (o) | 38.107 | Long. (o) | -121.6475 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018396 | Metagenome / Metatranscriptome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20216J20342_10187673 | F018396 | AGAAGG | VRPAWWHQWFGSRVSDNADALQRLLRKICRQETALAWHLADRARAVRFAPHRLSLEGLAARERQNAHAMARETGGEATLAPTASPAHRPGSLTATKLIQDLVEVEDLYTLYRQARWLTPDTILRDTLERMAAEEDHSSQTIRRILGTMDSYVTDRPS* |
| ⦗Top⦘ |