| Basic Information | |
|---|---|
| Taxon OID | 3300001800 Open in IMG/M |
| Scaffold ID | JGI24115J20150_1007926 Open in IMG/M |
| Source Dataset Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Mar_CSW14AB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2256 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, McLaughlin Reserve | |||||||
| Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069784 | Metagenome | 123 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24115J20150_10079264 | F069784 | GGA | MSKTANRQPLTVRLDPESKKLFSEEAEKCGLEAGVAARQILELYVQRLRESGDYIQTLADFSAALKTRTA* |
| ⦗Top⦘ |