NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24649J20148_1014384

Scaffold JGI24649J20148_1014384


Overview

Basic Information
Taxon OID3300001797 Open in IMG/M
Scaffold IDJGI24649J20148_1014384 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-81
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)519
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-28.4105Long. (o)179.1447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021867Metagenome217N

Sequences

Protein IDFamilyRBSSequence
JGI24649J20148_10143841F021867N/ANTAHFSSLAVAELKGYINKEDNIMDNNVEQVDWDKVNRGKVRYGFALELYKKGGELTPSGMGRIEAFVDFVMGDMEDEPAEEKQQSKLMSRLECKQVIETESEGSKAFVKAMVHIDASGLQDDDLEKVLQALKTGKITMDNLQASLDKIYSIKQSYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.