Scaffold BP130709S4_1452980

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BP130709S4_1452980

Scaffold BP130709S4_1452980

Overview

Basic Information
Taxon OID	3300001785 Open in IMG/M
Scaffold ID	BP130709S4_1452980 Open in IMG/M
Source Dataset Name	BioPara_130709_S4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	527
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Shimazuella → Shimazuella kribbensis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070019	Metagenome / Metatranscriptome	123	N

Sequences

Protein ID	Family	RBS	Sequence
BP130709S4_14529801	F070019	N/A	ATTNYMFSSEKEFIEDDKVDFILDLFSKAGKKLDDSVKIVYEHGLEEDGSGGIEDYEVVKYMQFAQNLSYNDYVILNAINEKANLLGIIDELGISKDRLNKSLEILEQNGYIKGFDITRNGKNILKNTNIQVVRTYYRYTVKPGLGDPIIPSSRKFCIQMITENRIYTKKEIDMI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.