Scaffold CSTRM40_1008948

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CSTRM40_1008948

Scaffold CSTRM40_1008948

Overview

Basic Information
Taxon OID	3300001760 Open in IMG/M
Scaffold ID	CSTRM40_1008948 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Belvaux, Luxembourg - M40
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1525
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location Name	Belvaux, Luxembourg
Coordinates	Lat. (^o)	49.506095	Long. (^o)	5.943536	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088842	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
CSTRM40_10089483	F088842	GAGG	MKNDEGIAYGLIAVVMFIGMVALIFICFTPAMNGVIGAANDLIGDGKVGVQTAGAVEWGLGWFGAIPLIALLGIGYWAYIRALEESPSD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.