Scaffold JGI997J19993_1000323

Overview

Basic Information

• Taxon OID: 3300001737
• Scaffold ID: JGI997J19993_1000323
• Source Dataset Name: Saline benthic water microbial community from Etoliko Lagoon, Greece
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 15340
• Total Scaffold Genes: 24
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (45.83%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Etoliko Lagoon, Greece
• Coordinates
  • Lat. (^o): 38.468307
  • Long. (^o): 21.333032
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054439	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI997J19993_100032311	F054439	GAG	MKQMAYARQLFGAKGKNKKQIALDVGYSPNVANSIKTHIENKPGFNYAMSALAVESNNLALEALSEFKARGLKDFSNKELTGALNAISNAWSKFNAPAIEQSNNAKEGNKLRKVILQQIENQTVNNNVKEEEKPRVIDVEVDDPNDF*