3300001737: Saline benthic water microbial community from Etoliko Lagoon, Greece

Overview

Basic Information

• IMG/M Taxon OID: 3300001737
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0058670 | Gp0054037 | Ga0026867
• Sample Name: Saline benthic water microbial community from Etoliko Lagoon, Greece
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 68840610
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → lagoon → saline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: Etoliko Lagoon, Greece
• Coordinates
  • Lat. (^o): 38.468307
  • Long. (^o): 21.333032
  • Alt. (m): N/A
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054439	Metagenome	140	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI997J19993_1000323	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	15340

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI997J19993_1000323	JGI997J19993_100032311	F054439	MKQMAYARQLFGAKGKNKKQIALDVGYSPNVANSIKTHIENKPGFNYAMSALAVESNNLALEALSEFKARGLKDFSNKELTGALNAISNAWSKFNAPAIEQSNNAKEGNKLRKVILQQIENQTVNNNVKEEEKPRVIDVEVDDPNDF*