Scaffold JGI24661J20069_1011047

Overview

Basic Information

• Taxon OID: 3300001723
• Scaffold ID: JGI24661J20069_1011047
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-144
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1516
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 29.1475
  • Long. (^o): -23.6838

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081439	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24661J20069_10110475	F081439	N/A	YYIDQKIIRHGKIDDMNLDQLYERMRTIKEKNEKLLEAKKLLKTNEESTSKGKGNTTKKLSLSPQIPDQDSTS*