Basic Information | |
---|---|
Taxon OID | 3300001707 Open in IMG/M |
Scaffold ID | supr50_115345 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Supr50 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Beebe Vents, Mid Cayman Rise | |||||||
Coordinates | Lat. (o) | 18.35 | Long. (o) | -81.85 | Alt. (m) | Depth (m) | 4000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013943 | Metagenome | 267 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
supr50_1153451 | F013943 | N/A | PTGTDSGLGIITGDAWPDGLYTKRGERRYVGPASLSRGMQQIDFPASDNIYGGPDSLNNERRAKRDAGKLYKYLSDPDGHSEVKANELRDDTPPLSPKQRIYGIHGFHRKQEYTIPPESANFHSTSETLIKPTTPPEGTKSGGIPATPEPGSKEMGSASGYRQAQKGGESIF |
⦗Top⦘ |