Scaffold supr50_103217

Overview

Basic Information

• Taxon OID: 3300001707
• Scaffold ID: supr50_103217
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Supr50
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1378
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location

• Location Name: Beebe Vents, Mid Cayman Rise
• Coordinates
  • Lat. (^o): 18.35
  • Long. (^o): -81.85
  • Depth (m): 4000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043455	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
supr50_1032171	F043455	N/A	MRKETVEEYLRRGKTITKIPQVLDTIGSIWNQQGIGADKDRHDHKKFGIRLQDWKSMQPDIRFDTEDDDRKYWNQLNKRCDKLIKKINKEQKKT*