Scaffold WOR8_10000257

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold WOR8_10000257

Scaffold WOR8_10000257

Overview

Basic Information
Taxon OID	3300001687 Open in IMG/M
Scaffold ID	WOR8_10000257 Open in IMG/M
Source Dataset Name	Deep Marine Sediments WOR-3-8_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	65325
Total Scaffold Genes	68 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	36 (52.94%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.640199	Long. (^o)	-77.109447	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070125	Metagenome / Metatranscriptome	123	N

Sequences

Protein ID	Family	RBS	Sequence
WOR8_1000025759	F070125	GGAGG	VTTAEERRQWIEALQAYREDSERLFALVASLANLLDEEMVVETMESVLGIAAVHDEDCVIFDDLAIRFGSDGRVKSVFRTIDGSGKGT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.